PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010556590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 82aa    MW: 9727.05 Da    PI: 9.3796
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010556590.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.14.8e-093272345
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +++ eE++l+ + +k+   + W++Ia +++ gR++k++  +w 
   XP_010556590.1 32 NMSREEEDLICRMHKLVRDR-WDLIAGRIP-GRSAKEVERFWV 72
                     6799**************99.*********.**********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.2E-72977IPR001005SANT/Myb domain
CDDcd001672.39E-63273No hitNo description
PfamPF002492.4E-83272IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-103473IPR009057Homeodomain-like
SuperFamilySSF466891.79E-73474IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
MDKHRKKQPK TNPPLVSSSS EEVSSIEWEE VNMSREEEDL ICRMHKLVRD RWDLIAGRIP  60
GRSAKEVERF WVTKNHRTSQ LP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010556590.12e-54PREDICTED: MYB-like transcription factor ETC3
SwissprotQ9LNI53e-29ETC1_ARATH; MYB-like transcription factor ETC1
TrEMBLV4MWM41e-36V4MWM4_EUTSA; Uncharacterized protein
STRINGBra037388.1-P2e-35(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01380.14e-28MYB_related family protein